Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SDF1 protein

This Mouse SDF1 protein spans the amino acid sequence from region 22-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

12-O-tetradecanoylphorbol 13-acetate repressed protein 1 , TPAR1C-X-C motif chemokine 12, Pre-B cell growth-stimulating factor , PBSFThymic lymphoma cell-stimulating factor , TLSF

UniProt

P40224

Expression Region

22-89aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

connexin 37 Double Nickase Plasmid (m2)
sc-420559-NIC-2 20 µg

connexin 37 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Hydrin 1
MBS8246644-01 1 mg

Hydrin 1

Sign In for Pricing
View Details
Hydrin 1
MBS8246644-02 5 mg

Hydrin 1

Sign In for Pricing
View Details
Hydrin 1
MBS8246644-03 10 mg

Hydrin 1

Sign In for Pricing
View Details
Hydrin 1
MBS8246644-04 5x 10 mg

Hydrin 1

Sign In for Pricing
View Details
Epitumomab Biosimilar - Research Grade
ICH5530-20mg 20 mg

Epitumomab Biosimilar - Research Grade

Sign In for Pricing
View Details