Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SDF1 protein

This Mouse SDF1 protein spans the amino acid sequence from region 22-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

12-O-tetradecanoylphorbol 13-acetate repressed protein 1 , TPAR1C-X-C motif chemokine 12, Pre-B cell growth-stimulating factor , PBSFThymic lymphoma cell-stimulating factor , TLSF

UniProt

P40224

Expression Region

22-89aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BORCS7 sgRNA gene knockout kit - Lentiviral human BORCS7 sgRNA gene knockout kit (plasmid)
GTR15385916 1 Vial

Lentiviral human BORCS7 sgRNA gene knockout kit - Lentiviral human BORCS7 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human Sjoegren syndrome nuclear autoantigen 1 (SSNA1) ELISA Kit
abx547455 96 Tests

Human Sjoegren syndrome nuclear autoantigen 1 (SSNA1) ELISA Kit

Sign In for Pricing
View Details
CPNE8 peptide
orb319350-01 1 mg

CPNE8 peptide

Sign In for Pricing
View Details
CPNE8 peptide
orb319350-02 5 mg

CPNE8 peptide

Sign In for Pricing
View Details
Human Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 (LYVE1) Protein
abx660058-01 10 µg

Human Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 (LYVE1) Protein

Sign In for Pricing
View Details
Human Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 (LYVE1) Protein
abx660058-02 50 µg

Human Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 (LYVE1) Protein

Sign In for Pricing
View Details