Mouse Interferon gamma protein
This Mouse Interferon gamma protein spans the amino acid sequence from region 22-126aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Gamma-interferon-induced monokine, Monokine induced by interferon-gamma , MIG , MuMIGProtein m119Small-inducible cytokine B9
UniProt
P18340
Expression Region
22-126aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FAB10543G-100UG 100 µg
Human OX40/TNFRSF4 Alexa Fluor 488 MAb (Clone 977974)
Sign In for Pricing
View Details TMPH-00070-01 5 µg
Major allergen Api g 1, isoallergen 2 Protein, Apium graveolens, Recombinant (His)
Sign In for Pricing
View Details TMPH-00070-02 10 µg
Major allergen Api g 1, isoallergen 2 Protein, Apium graveolens, Recombinant (His)
Sign In for Pricing
View Details TMPH-00070-03 20 µg
Major allergen Api g 1, isoallergen 2 Protein, Apium graveolens, Recombinant (His)
Sign In for Pricing
View Details TMPH-00070-04 50 µg
Major allergen Api g 1, isoallergen 2 Protein, Apium graveolens, Recombinant (His)
Sign In for Pricing
View Details TMPH-00070-05 100 µg
Major allergen Api g 1, isoallergen 2 Protein, Apium graveolens, Recombinant (His)
Sign In for Pricing
View Details