Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Interferon gamma protein

This Mouse Interferon gamma protein spans the amino acid sequence from region 22-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gamma-interferon-induced monokine, Monokine induced by interferon-gamma , MIG , MuMIGProtein m119Small-inducible cytokine B9

UniProt

P18340

Expression Region

22-126aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C3, C3c (Complement Component C3c, C3/C3c, Acylation Stimulating Protein Cleavage Product, ASP, Complement Component 3, Complement Factor 3, CPAMD1) (Biotin)
C7850-14T2 1 mL

Complement C3, C3c (Complement Component C3c, C3/C3c, Acylation Stimulating Protein Cleavage Product, ASP, Complement Component 3, Complement Factor 3, CPAMD1) (Biotin)

Sign In for Pricing
View Details
NOV/CCN3 Rabbit Polyclonal Antibody (Fluoro594)
orb3102057 100 µg

NOV/CCN3 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
CPSF1 (NM_013291) Human Untagged Clone
SC115303 10 µg

CPSF1 (NM_013291) Human Untagged Clone

Sign In for Pricing
View Details
PANK2 Antibody
MBS8581564-01 0.1 mL

PANK2 Antibody

Sign In for Pricing
View Details
PANK2 Antibody
MBS8581564-02 0.1 mL (AF635)

PANK2 Antibody

Sign In for Pricing
View Details
PANK2 Antibody
MBS8581564-03 0.1 mL (AF610)

PANK2 Antibody

Sign In for Pricing
View Details