Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ccl25 protein

This Mouse Ccl25 protein spans the amino acid sequence from region 25-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chemokine TECKSmall-inducible cytokine A25Thymus-expressed chemokine

UniProt

O35903

Expression Region

25-144aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR4A3 (N) Antibody, Rabbit Polyclonal
orb386984 100 µL

NR4A3 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Recombinant Human VSIG4/CRIg Protein, C-His
orb3059641-01 50 µg

Recombinant Human VSIG4/CRIg Protein, C-His

Sign In for Pricing
View Details
Recombinant Human VSIG4/CRIg Protein, C-His
orb3059641-02 100 µg

Recombinant Human VSIG4/CRIg Protein, C-His

Sign In for Pricing
View Details
Recombinant Human VSIG4/CRIg Protein, C-His
orb3059641-03 1 mg

Recombinant Human VSIG4/CRIg Protein, C-His

Sign In for Pricing
View Details
CCDC52 Polyclonal Conjugated Antibody
orb1628487 100 µL

CCDC52 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
PHETA2 (NM_001002034) Human Over-expression Lysate
LS150368 100 µg

PHETA2 (NM_001002034) Human Over-expression Lysate

Sign In for Pricing
View Details