Mouse Ccl25 protein
This Mouse Ccl25 protein spans the amino acid sequence from region 25-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Chemokine TECKSmall-inducible cytokine A25Thymus-expressed chemokine
UniProt
O35903
Expression Region
25-144aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
127947 100 µg
HMG20B (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily E Member 1-related, SMARCE1-related Protein, BRCA2-associated Factor 35, HMG Box-containing Protein 20B, HMG Domain-containing Protein 2, HMG Domain-containing Protein HMGX2, Sox-like Transcriptional Factor, Structural DNA-binding Protein BRAF35, BRAF35, HMGX2, HMGXB2, SMARCE1R)
Sign In for Pricing
View Details MBS1057290-01 0.02 mg (E-Coli)
Recombinant Paracoccus denitrificans Homoserine O-succinyltransferase (metA)
Sign In for Pricing
View Details MBS1057290-02 0.02 mg (Yeast)
Recombinant Paracoccus denitrificans Homoserine O-succinyltransferase (metA)
Sign In for Pricing
View Details MBS1057290-03 0.1 mg (E-Coli)
Recombinant Paracoccus denitrificans Homoserine O-succinyltransferase (metA)
Sign In for Pricing
View Details MBS1057290-04 0.1 mg (Yeast)
Recombinant Paracoccus denitrificans Homoserine O-succinyltransferase (metA)
Sign In for Pricing
View Details