Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPBP protein

This Human PPBP protein spans the amino acid sequence from region 59-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 7Leukocyte-derived growth factor , LDGFMacrophage-derived growth factor , MDGFSmall-inducible cytokine B7

UniProt

P02775

Expression Region

59-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCND3 Antibody
A73470-100UL 100 µL

KCND3 Antibody

Sign In for Pricing
View Details
Brilliant Violet 650™ anti-human TNF-α
GT18258 100 Tests

Brilliant Violet 650™ anti-human TNF-α

Sign In for Pricing
View Details
Recombinant HRSV Post-F/Fusion glycoprotein F0 Protein, C-His-Strep
AP93714 50 µg

Recombinant HRSV Post-F/Fusion glycoprotein F0 Protein, C-His-Strep

Sign In for Pricing
View Details
Anti-mouse PD-1 (CD279) -InVivo
C00073-5mg*5 5x 5mg

Anti-mouse PD-1 (CD279) -InVivo

Sign In for Pricing
View Details
Recombinant Islet Cell Autoantigen 1 (ICA1)
MBS2012459-01 0.01 mg

Recombinant Islet Cell Autoantigen 1 (ICA1)

Sign In for Pricing
View Details
Recombinant Islet Cell Autoantigen 1 (ICA1)
MBS2012459-02 0.05 mg

Recombinant Islet Cell Autoantigen 1 (ICA1)

Sign In for Pricing
View Details