Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL3 protein

This Human CXCL3 protein spans the amino acid sequence from region 35-107aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GRO-gamma (1-73) Growth-regulated protein gamma , GRO-gammaMacrophage inflammatory protein 2-beta , MIP2-beta

UniProt

P19876

Expression Region

35-107aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Cystatin C (Cys-C)
TRV-0044215-01 24 Tests

ELISA Kit for Cystatin C (Cys-C)

Sign In for Pricing
View Details
ELISA Kit for Cystatin C (Cys-C)
TRV-0044215-02 48 Tests

ELISA Kit for Cystatin C (Cys-C)

Sign In for Pricing
View Details
ELISA Kit for Cystatin C (Cys-C)
TRV-0044215-03 96 Tests

ELISA Kit for Cystatin C (Cys-C)

Sign In for Pricing
View Details
ELISA Kit for Cystatin C (Cys-C)
TRV-0044215-04 5x 96 Tests

ELISA Kit for Cystatin C (Cys-C)

Sign In for Pricing
View Details
ELISA Kit for Cystatin C (Cys-C)
TRV-0044215-05 10x 96 Tests

ELISA Kit for Cystatin C (Cys-C)

Sign In for Pricing
View Details
Recombinant Oligotropha carboxidovorans Integration host factor subunit beta (ihfB)
MBS1182673-01 0.02 mg (E-Coli)

Recombinant Oligotropha carboxidovorans Integration host factor subunit beta (ihfB)

Sign In for Pricing
View Details