Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli rpmA protein

This E. coli rpmA protein spans the amino acid sequence from region 2-85aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpmA, b3185, JW3152, 50S ribosomal protein L27, Large ribosomal subunit protein bL27

UniProt

P0A7L8

Expression Region

2-85aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM5 (Phosphoglucomutase-Like Protein 5, Phosphoglucomutase 5)
488516 100 µL

PGM5 (Phosphoglucomutase-Like Protein 5, Phosphoglucomutase 5)

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-518d-3p Vector
mh30924 500 ng

LentimiRa-Off-hsa-miR-518d-3p Vector

Sign In for Pricing
View Details
Rat Cd22 Pre-designed siRNA Set A
SI202292A 1 Each

Rat Cd22 Pre-designed siRNA Set A

Sign In for Pricing
View Details
THUM3, ID (THUMPD3, THUMP domain-containing protein 3) (Azide free) (HRP) discontinued
042820-HRP 200 µL

THUM3, ID (THUMPD3, THUMP domain-containing protein 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Lentiviral human ANK2 shRNA (UAS) - Lentiviral human ANK2 shRNA (UAS) plasmid
GTR15307810 1 Vial

Lentiviral human ANK2 shRNA (UAS) - Lentiviral human ANK2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
TMEM181 Protein Vector (Human) (pPB-N-His)
PV136071 500 ng

TMEM181 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details