Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli rpmA protein

This E. coli rpmA protein spans the amino acid sequence from region 2-85aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpmA, b3185, JW3152, 50S ribosomal protein L27, Large ribosomal subunit protein bL27

UniProt

P0A7L8

Expression Region

2-85aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFAKADGKVKFEVKGPKNRKFISIEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bedaquiline fumarate
S4854-25mg 25 mg

Bedaquiline fumarate

Sign In for Pricing
View Details
ADAM8 Rabbit Polyclonal Antibody (BF555)
orb1581106 100 µL

ADAM8 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Human CellExp™ Tim-3, (Fc-Tag Mouse), Mouse Recombinant
P1360-50 50 µg

Human CellExp™ Tim-3, (Fc-Tag Mouse), Mouse Recombinant

Sign In for Pricing
View Details
Nfu1 3'UTR GFP Stable Cell Line
TU164051 1.0 mL

Nfu1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human GBGT1 shRNA (UAS) - Lentiviral human GBGT1 shRNA (UAS, GFP) plasmid
GTR15142942 1 Vial

Lentiviral human GBGT1 shRNA (UAS) - Lentiviral human GBGT1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
HELLS Rabbit Polyclonal Antibody (PE)
orb2584029 100 µg

HELLS Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details