Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine TNF protein

This Bovine TNF protein spans the amino acid sequence from region 78-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin, TNF-alphaTumor necrosis factor ligand superfamily member 2 , TNF-a

UniProt

Q06599

Expression Region

78-234aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC5A2 Antibody
MBS9510225-01 0.05 mL

SLC5A2 Antibody

Sign In for Pricing
View Details
SLC5A2 Antibody
MBS9510225-02 0.1 mL

SLC5A2 Antibody

Sign In for Pricing
View Details
SLC5A2 Antibody
MBS9510225-03 5x 0.1 mL

SLC5A2 Antibody

Sign In for Pricing
View Details
PIK3CG (Phosphatidylinositol 4,5-bisphosphate 3-Kinase Catalytic Subunit gamma isoform, PI3-Kinase Subunit gamma, PI3K-gamma, PI3Kgamma, PtdIns-3-Kinase Subunit gamma, Phosphatidylinositol 4,5-bisphosphate 3-Kinase 110kD Catalytic Subunit gamma, PtdIns-3-kinase) discontinued
329623 100 µL

PIK3CG (Phosphatidylinositol 4,5-bisphosphate 3-Kinase Catalytic Subunit gamma isoform, PI3-Kinase Subunit gamma, PI3K-gamma, PI3Kgamma, PtdIns-3-Kinase Subunit gamma, Phosphatidylinositol 4,5-bisphosphate 3-Kinase 110kD Catalytic Subunit gamma, PtdIns-3-kinase) discontinued

Sign In for Pricing
View Details
Duck Dihydropyrimidinase-Related Protein 5 (DPYSL5) ELISA Kit
MBS9908392 Inquire

Duck Dihydropyrimidinase-Related Protein 5 (DPYSL5) ELISA Kit

Sign In for Pricing
View Details
NBPF5
525806-01 100 µL

NBPF5

Sign In for Pricing
View Details