Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine TNF protein

This Bovine TNF protein spans the amino acid sequence from region 78-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin, TNF-alphaTumor necrosis factor ligand superfamily member 2 , TNF-a

UniProt

Q06599

Expression Region

78-234aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FRS2 Protein, N-His-SUMO
orb2832997-01 20 µg

Recombinant Human FRS2 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human FRS2 Protein, N-His-SUMO
orb2832997-02 50 µg

Recombinant Human FRS2 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human FRS2 Protein, N-His-SUMO
orb2832997-03 100 µg

Recombinant Human FRS2 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant ASFV War-090 Protein (aa 1-385)
VAng-2496Lsx-500g 500 µg

Recombinant ASFV War-090 Protein (aa 1-385)

Sign In for Pricing
View Details
ASPH Antibody
orb1240878 100 µL

ASPH Antibody

Sign In for Pricing
View Details
Human KIAA0895L Recombinant Protein
PPT-13508 100 µg

Human KIAA0895L Recombinant Protein

Sign In for Pricing
View Details