Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine TNF protein

This Bovine TNF protein spans the amino acid sequence from region 78-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin, TNF-alphaTumor necrosis factor ligand superfamily member 2 , TNF-a

UniProt

Q06599

Expression Region

78-234aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF488A conjugate, 0.1mg/mL
BNC882748-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Propenylfuran (>80%)
TRC-P709280-500MG 500 mg

2-Propenylfuran (>80%)

Sign In for Pricing
View Details
DYR1B Antibody
8C11955-AAT 50 µg

DYR1B Antibody

Sign In for Pricing
View Details
Baohuoside I
TRC-B117950-10MG 10 mg

Baohuoside I

Sign In for Pricing
View Details
CACNG7 (NM_031896) Human Over-expression Lysate
LC403128 20 µg

CACNG7 (NM_031896) Human Over-expression Lysate

Sign In for Pricing
View Details
SEC62 Recombinant Rabbit monoclonal Antibody
HA750671 100 µL

SEC62 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details