Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL8 protein

This Human CXCL8 protein spans the amino acid sequence from region 23-99aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin, Granulocyte chemotactic protein 1 , GCP-1Monocyte-derived neutrophil chemotactic factor , MDNCFMonocyte-derived neutrophil-activating peptide , MONAPNeutrophil-activating protein 1 , NAP-1, Protein 3-10CT-cell chemotactic factor

UniProt

P10145

Expression Region

23-99aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnmt3L Mouse mAb
orb2714220-01 50 µL

Dnmt3L Mouse mAb

Sign In for Pricing
View Details
Dnmt3L Mouse mAb
orb2714220-02 100 µL

Dnmt3L Mouse mAb

Sign In for Pricing
View Details
Mouse Monoclonal SLC38A1 Antibody (S104-32) [Alexa Fluor 488]
NBP2-59311AF488 100 µL

Mouse Monoclonal SLC38A1 Antibody (S104-32) [Alexa Fluor 488]

Sign In for Pricing
View Details
TSPYL5 (NM_033512) Human Recombinant Protein
PH38680M5 20 µg

TSPYL5 (NM_033512) Human Recombinant Protein

Sign In for Pricing
View Details
Cdh16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
15657116 3x 1.0 µg

Cdh16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ZNF434 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-13586R-BF555 100 µL

ZNF434 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details