Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL8 protein

This Human CXCL8 protein spans the amino acid sequence from region 23-99aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin, Granulocyte chemotactic protein 1 , GCP-1Monocyte-derived neutrophil chemotactic factor , MDNCFMonocyte-derived neutrophil-activating peptide , MONAPNeutrophil-activating protein 1 , NAP-1, Protein 3-10CT-cell chemotactic factor

UniProt

P10145

Expression Region

23-99aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZFC3H1 qPCR Primer Pair
QH67493S 200 Tests

Human ZFC3H1 qPCR Primer Pair

Sign In for Pricing
View Details
JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1, JAMIP1, FLJ31564, GABA-B Receptor-binding Protein, GABABRBP, Multiple alpha-helices and RNA-linker Protein 1, MARLIN1, Marlin-1)
J0904 200 µL

JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1, JAMIP1, FLJ31564, GABA-B Receptor-binding Protein, GABABRBP, Multiple alpha-helices and RNA-linker Protein 1, MARLIN1, Marlin-1)

Sign In for Pricing
View Details
AU*Anti Human Ig LAMBDA
SA0191 100 µL

AU*Anti Human Ig LAMBDA

Sign In for Pricing
View Details
Fluhunter-229E-SARS-Real
FR154 100 Reactions

Fluhunter-229E-SARS-Real

Sign In for Pricing
View Details
KRT12 sgRNA CRISPR Lentivector (Human) (Target 1)
K1169102 1.0 µg DNA

KRT12 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker), 0.2mg/mL
BNUB1657-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker), 0.2mg/mL

Sign In for Pricing
View Details