Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Vegfa protein

This Rat Vegfa protein spans the amino acid sequence from region 27-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular permeability factor , VPF

UniProt

P16612

Expression Region

27-214aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclic triadenosine monophosphate (c-triAMP / c[A (3',5') pA (3',5') pA (3',5') p] / cyclic triadenylate / c-A3), sodium salt
C 362-05 5x 1 µmol

Cyclic triadenosine monophosphate (c-triAMP / c[A (3',5') pA (3',5') pA (3',5') p] / cyclic triadenylate / c-A3), sodium salt

Sign In for Pricing
View Details
DMP1 Protein Vector (Human) (pPM-C-HA)
PV051403 500 ng

DMP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Phospho-PLCG2-Y759 pAb
MBS9135638-01 0.02 mL

Phospho-PLCG2-Y759 pAb

Sign In for Pricing
View Details
Phospho-PLCG2-Y759 pAb
MBS9135638-02 0.1 mL

Phospho-PLCG2-Y759 pAb

Sign In for Pricing
View Details
Phospho-PLCG2-Y759 pAb
MBS9135638-03 5x 0.1 mL

Phospho-PLCG2-Y759 pAb

Sign In for Pricing
View Details
Rabbit Polyclonal NKX2.8 Antibody [DyLight 488]
NBP2-81773G 0.1 mL

Rabbit Polyclonal NKX2.8 Antibody [DyLight 488]

Sign In for Pricing
View Details