Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Vegfa protein

This Rat Vegfa protein spans the amino acid sequence from region 27-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular permeability factor , VPF

UniProt

P16612

Expression Region

27-214aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam178b Mouse shRNA Plasmid (Locus ID 381337)
TL508596 1 Kit

Fam178b Mouse shRNA Plasmid (Locus ID 381337)

Sign In for Pricing
View Details
CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1)(BSA & Azide Free)
MBS6507171-01 0.1 mg

CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1)(BSA & Azide Free)

Sign In for Pricing
View Details
CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1)(BSA & Azide Free)
MBS6507171-02 5x 0.1 mg

CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1)(BSA & Azide Free)

Sign In for Pricing
View Details
PECI Antibody (C-term)
E45R09033G-4 50 µL

PECI Antibody (C-term)

Sign In for Pricing
View Details
Histone H3, phosphorylated (Ser10) (Histone H3.1, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ) (AP) discontinued
H5110-12A1-AP 200 µL

Histone H3, phosphorylated (Ser10) (Histone H3.1, H3/a, H3/b, H3/c, H3/d, H3/f, H3/h, H3/i, H3/j, H3/k, H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ) (AP) discontinued

Sign In for Pricing
View Details
Tmem161a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6020205 3x 1.0 µg

Tmem161a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details