Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD106 protein

This Human CD106 protein spans the amino acid sequence from region 1003-1114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD171

UniProt

P32004

Expression Region

1003-1114aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC40 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0375705 3x 1.0 µg

CCDC40 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CRYBB1 (Crystallin, beta B1, CATCN3) (MaxLight 650)
MBS6227089-01 0.1 mL

CRYBB1 (Crystallin, beta B1, CATCN3) (MaxLight 650)

Sign In for Pricing
View Details
CRYBB1 (Crystallin, beta B1, CATCN3) (MaxLight 650)
MBS6227089-02 5x 0.1 mL

CRYBB1 (Crystallin, beta B1, CATCN3) (MaxLight 650)

Sign In for Pricing
View Details
SCFD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]
TA504662AM 100 µL

SCFD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]

Sign In for Pricing
View Details
Znhit2-ps sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4930508 1.0 µg DNA

Znhit2-ps sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FAM215A Antibody
E40PV1380 50 µL

FAM215A Antibody

Sign In for Pricing
View Details