Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD106 protein

This Human CD106 protein spans the amino acid sequence from region 1003-1114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD171

UniProt

P32004

Expression Region

1003-1114aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PMEL Reference Antibody (Genentech anti-PMEL17)
M01262-4 100 µg

Anti-PMEL Reference Antibody (Genentech anti-PMEL17)

Sign In for Pricing
View Details
GNA14 Protein Vector (Mouse) (pPM-C-HA)
22294024 500 ng

GNA14 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
DPP3 CRISPR Activation Plasmid (h2)
sc-407412-ACT-2 20 µg

DPP3 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
(3S) -3-Amino-3- (2-methylphenyl) propanoic acid hydrochloride
QUA03462 2.5 g

(3S) -3-Amino-3- (2-methylphenyl) propanoic acid hydrochloride

Sign In for Pricing
View Details
Mouse Monoclonal Lipocalin-2/NGAL Antibody (14) [mFluor Violet 610 SE]
NBP2-41364MFV610 0.1 mL

Mouse Monoclonal Lipocalin-2/NGAL Antibody (14) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
TBC1D29P Human Over-expression Lysate
orb1368891 20 µg

TBC1D29P Human Over-expression Lysate

Sign In for Pricing
View Details