Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TGF beta 1 protein

This Human TGF beta 1 protein spans the amino acid sequence from region 281-390aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cartilage-inducing factor, CED, Differentiation inhibiting factor, DPD1, LAP, Latency-associated peptide, Prepro transforming growth factor beta 1, TGF beta 1, TGF beta, TGF beta 1 protein, TGF-beta 1 protein, TGF-beta-1, TGF-beta-5, TGF-beta1, TGFB, Tgfb-1, tgfb1, TGFB1_HUMAN, TGFbeta, TGFbeta1, Transforming Growth Factor b1, Transforming Growth Factor beta 1, Transforming growth factor beta 1a, transforming growth factor beta-1, transforming growth factor, beta 1, Transforming Growth Factor-?

UniProt

P01137

Expression Region

281-390aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF/LE Purified Anti-Human CD80 Antibody[2D10]
E-AB-F12320-01 100 µg

AF/LE Purified Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD80 Antibody[2D10]
E-AB-F12320-02 1 mg

AF/LE Purified Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD80 Antibody[2D10]
E-AB-F12320-03 5 mg

AF/LE Purified Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD80 Antibody[2D10]
E-AB-F12320-04 25 mg

AF/LE Purified Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD80 Antibody[2D10]
E-AB-F12320-05 50 mg

AF/LE Purified Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD80 Antibody[2D10]
E-AB-F12320-06 100 mg

AF/LE Purified Anti-Human CD80 Antibody[2D10]

Sign In for Pricing
View Details