Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human alpha Synuclein protein

This Human alpha Synuclein protein spans the amino acid sequence from region 1-139AA. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-A beta component of AD amyloidNon-A4 component of amyloid precursor , NACP

UniProt

P37840

Expression Region

1-139AA

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znf839 3'UTR Lenti-reporter-Luc Vector
51876086 1.0 µg

Znf839 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PIGM CRISPR All-in-one AAV vector set (with saCas9)(Human)
36657151 3x 1.0 µg DNA

PIGM CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Clvs2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3611006 1.0 µg DNA

Clvs2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Human HESX1 (His)
orb3067767 50 µg

Recombinant Human HESX1 (His)

Sign In for Pricing
View Details
Hypercalin B
TN10475-01 10 mg

Hypercalin B

Sign In for Pricing
View Details
Hypercalin B
TN10475-02 50 mg

Hypercalin B

Sign In for Pricing
View Details