Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human alpha Synuclein protein

This Human alpha Synuclein protein spans the amino acid sequence from region 1-139AA. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-A beta component of AD amyloidNon-A4 component of amyloid precursor , NACP

UniProt

P37840

Expression Region

1-139AA

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnrc6c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
47267114 3x 1.0 µg

Tnrc6c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Cathepsin D Rabbit pAb, BF700 conjugated
orb2819700 100 µL

Cathepsin D Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse Myelin-Associated Oligodendrocyte Basic Protein (MOBP) ELISA Kit
abx389949 96 Tests

Mouse Myelin-Associated Oligodendrocyte Basic Protein (MOBP) ELISA Kit

Sign In for Pricing
View Details
GCH1 Antibody
R34104-100UG 100 µg

GCH1 Antibody

Sign In for Pricing
View Details
DNAJB5 (HSC40, DnaJ Homolog Subfamily B Member 5, Heat Shock Protein Hsp40-2, Heat Shock Protein Hsp40-3, Heat Shock Protein Cognate 40) (HRP)
MBS6152184-01 0.1 mL

DNAJB5 (HSC40, DnaJ Homolog Subfamily B Member 5, Heat Shock Protein Hsp40-2, Heat Shock Protein Hsp40-3, Heat Shock Protein Cognate 40) (HRP)

Sign In for Pricing
View Details
DNAJB5 (HSC40, DnaJ Homolog Subfamily B Member 5, Heat Shock Protein Hsp40-2, Heat Shock Protein Hsp40-3, Heat Shock Protein Cognate 40) (HRP)
MBS6152184-02 5x 0.1 mL

DNAJB5 (HSC40, DnaJ Homolog Subfamily B Member 5, Heat Shock Protein Hsp40-2, Heat Shock Protein Hsp40-3, Heat Shock Protein Cognate 40) (HRP)

Sign In for Pricing
View Details