Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human alpha Synuclein protein

This Human alpha Synuclein protein spans the amino acid sequence from region 1-139AA. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-A beta component of AD amyloidNon-A4 component of amyloid precursor , NACP

UniProt

P37840

Expression Region

1-139AA

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT3 (CCR4-NOT Transcription Complex Subunit 3, NOT3, LENG2, NOT3H) (APC)
MBS6411944-01 0.1 mL

CNOT3 (CCR4-NOT Transcription Complex Subunit 3, NOT3, LENG2, NOT3H) (APC)

Sign In for Pricing
View Details
CNOT3 (CCR4-NOT Transcription Complex Subunit 3, NOT3, LENG2, NOT3H) (APC)
MBS6411944-02 5x 0.1 mL

CNOT3 (CCR4-NOT Transcription Complex Subunit 3, NOT3, LENG2, NOT3H) (APC)

Sign In for Pricing
View Details
Easypro Mouse IL-1Ra/Il-1F3 (Interleukin 1 Receptor Antagonist) ELISA Kit
FY-EM1048S 96 Well

Easypro Mouse IL-1Ra/Il-1F3 (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
PRLR Recombinant Antibody [1D3] (OACA12204)
OACA12204-100UL 100 µL

PRLR Recombinant Antibody [1D3] (OACA12204)

Sign In for Pricing
View Details
Interleukin-1 receptor antagonist Polyclonal Conjugated Antibody
C42463 100 µL

Interleukin-1 receptor antagonist Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Bovine C- Peptide, connecting peptide ELISA Kit
CELI-66099b 96 Tests

Bovine C- Peptide, connecting peptide ELISA Kit

Sign In for Pricing
View Details