Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF protein

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycosylation-inhibiting factor , GIFL-dopachrome isomeraseL-dopachrome tautomerase (EC, 5.3.3.12) Phenylpyruvate tautomerase

UniProt

P14174

Expression Region

2-115aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPAT5 Peptide
DF3641-BP 1 mg

AGPAT5 Peptide

Sign In for Pricing
View Details
SAMD11 Rabbit Polyclonal Antibody (AP)
orb959399 100 µL

SAMD11 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Abpe Protein Vector (Mouse) (pPB-C-His)
PV151474 500 ng

Abpe Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ATP6V0A4 Protein Vector (Human) (pPM-C-HA)
PV049123 500 ng

ATP6V0A4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit ARMC6 Antibody
orb1520695-01 10 µL

Rabbit ARMC6 Antibody

Sign In for Pricing
View Details
Rabbit ARMC6 Antibody
orb1520695-02 100 µL

Rabbit ARMC6 Antibody

Sign In for Pricing
View Details