Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL6 protein

This Human IL6 protein spans the amino acid sequence from region 30-212aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 2 , BSF-2, CTL differentiation factor , CDFHybridoma growth factorInterferon beta-2 , IFN-beta-2

UniProt

P05231

Expression Region

30-212aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL.

Form

Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Platelet Derived Growth Factor AA (PDGFAA) ELISA Kit
abx570509 96 Well

Human Platelet Derived Growth Factor AA (PDGFAA) ELISA Kit

Sign In for Pricing
View Details
KCND1 Antibody
orb127005-01 25 µg

KCND1 Antibody

Sign In for Pricing
View Details
KCND1 Antibody
orb127005-02 50 µg

KCND1 Antibody

Sign In for Pricing
View Details
KCND1 Antibody
orb127005-03 100 µg

KCND1 Antibody

Sign In for Pricing
View Details
KCND1 Antibody
orb127005-04 200 µg

KCND1 Antibody

Sign In for Pricing
View Details
ROMO1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]
TA505583BM 100 µL

ROMO1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C7]

Sign In for Pricing
View Details