Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL6 protein

This Human IL6 protein spans the amino acid sequence from region 30-212aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 2 , BSF-2, CTL differentiation factor , CDFHybridoma growth factorInterferon beta-2 , IFN-beta-2

UniProt

P05231

Expression Region

30-212aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL.

Form

Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Xbp1 Pre-designed siRNA Set A
SI216044A 1 Each

Rat Xbp1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lung cancer tissue array, with ALK results, 150 cases/150 cores-NSC151
NSC151 each

Lung cancer tissue array, with ALK results, 150 cases/150 cores-NSC151

Sign In for Pricing
View Details
DHRS2 sgRNA CRISPR Lentivector set (Human)
K0598701 3x 1.0 µg

DHRS2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
NTM-IT1 Protein Lysate (Human) with C-Ha Tag
32243031 100 µg

NTM-IT1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Dhfr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6915305 3x 1.0 µg

Dhfr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
EIF4A1 Recombinant Antibody, APC Conjugated
bsm-61878R-APC-01 20 µL

EIF4A1 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details