Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL6 protein

This Human IL6 protein spans the amino acid sequence from region 30-212aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 2 , BSF-2, CTL differentiation factor , CDFHybridoma growth factorInterferon beta-2 , IFN-beta-2

UniProt

P05231

Expression Region

30-212aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL.

Form

Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD7 (26S Proteasome non-ATPase Regulatory Subunit 7, 26S Proteasome Regulatory Subunit RPN8, 26S Proteasome Regulatory Subunit S12, Proteasome Subunit p40, Mov34 Protein Homolog, MOV34L) (MaxLight 750) discontinued
131985-ML750 100 µL

PSMD7 (26S Proteasome non-ATPase Regulatory Subunit 7, 26S Proteasome Regulatory Subunit RPN8, 26S Proteasome Regulatory Subunit S12, Proteasome Subunit p40, Mov34 Protein Homolog, MOV34L) (MaxLight 750) discontinued

Sign In for Pricing
View Details
AREL1 Antibody
KC-2344-01 50 μL

AREL1 Antibody

Sign In for Pricing
View Details
AREL1 Antibody
KC-2344-02 100 µL

AREL1 Antibody

Sign In for Pricing
View Details
AREL1 Antibody
KC-2344-03 1 mL

AREL1 Antibody

Sign In for Pricing
View Details
Human ZSCAN22 Protein Lysate
MBS8430426-01 0.02 mg

Human ZSCAN22 Protein Lysate

Sign In for Pricing
View Details
Human ZSCAN22 Protein Lysate
MBS8430426-02 5x 0.02 mg

Human ZSCAN22 Protein Lysate

Sign In for Pricing
View Details