Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL1B protein

This Human IL1B protein spans the amino acid sequence from region 117-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Catabolin

UniProt

P01584

Expression Region

117-269aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sqstm1 3'UTR GFP Stable Cell Line
TU271153 1.0 mL

Sqstm1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GNAL Rabbit pAb, BF700 conjugated
orb2877833 100 µL

GNAL Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
C13orf30 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV815528 1.0 µg DNA

C13orf30 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
NDUFA5 ORF Vector (Human) (pORF)
ORF006981 1.0 µg DNA

NDUFA5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Chicken Gastrokine 2 ELISA Kit
OM625494 96 Strip Well

Chicken Gastrokine 2 ELISA Kit

Sign In for Pricing
View Details
Rat Trim21 Pre-designed siRNA Set B
SI215159B 1 Each

Rat Trim21 Pre-designed siRNA Set B

Sign In for Pricing
View Details