Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL1 alpha protein

This Human IL1 alpha protein spans the amino acid sequence from region 113-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hematopoietin-1

UniProt

P01583

Expression Region

113-271aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC283341 Human qPCR Primer Pair (XM_208071)
HP221246 200 Reactions

LOC283341 Human qPCR Primer Pair (XM_208071)

Sign In for Pricing
View Details
RAB11FIP4 Antibody Blocking peptide
orb1443883 500 µg

RAB11FIP4 Antibody Blocking peptide

Sign In for Pricing
View Details
Chicken Cluster Of Differentiation 30 Ligand (CD30L) ELISA Kit
DLR-CD30L-Ch-48T 48 Tests

Chicken Cluster Of Differentiation 30 Ligand (CD30L) ELISA Kit

Sign In for Pricing
View Details
Adamantinoma and hamartoma tissue array, 40 cases/80 cores
MC804 1 Each

Adamantinoma and hamartoma tissue array, 40 cases/80 cores

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/3121R), CF640R conjugate, 0.1mg/mL
BNC403121-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/3121R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Ashwin (Ash) ELISA Kit
MBS9312986-01 48 Well

Human Ashwin (Ash) ELISA Kit

Sign In for Pricing
View Details