Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1 protein

This Human IGF1 protein spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mechano growth factor , MGFSomatomedin-C

UniProt

P05019

Expression Region

49-118aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-6Ra / CD126 (APX007)
C00714-1mg*5 5x 1mg

Anti-IL-6Ra / CD126 (APX007)

Sign In for Pricing
View Details
L-Valine-d8
V8400 5 mg

L-Valine-d8

Sign In for Pricing
View Details
Progesterone Mouse Monoclonal Antibody
orb2959376-01 50 µg

Progesterone Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Progesterone Mouse Monoclonal Antibody
orb2959376-02 100 µg

Progesterone Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Progesterone Mouse Monoclonal Antibody
orb2959376-03 1 mg

Progesterone Mouse Monoclonal Antibody

Sign In for Pricing
View Details
mmu-miR-106b-3p miRNA Inhibitor
MBS8295792-01 10 nmol

mmu-miR-106b-3p miRNA Inhibitor

Sign In for Pricing
View Details