Human IGF1 protein
This Human IGF1 protein spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mechano growth factor , MGFSomatomedin-C
UniProt
P05019
Expression Region
49-118aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
JL22461-01 48 Tests
Bovine Cross Linked C-telopeptide Of Type I Collagen (CTX-I) ELISA Kit
Sign In for Pricing
View Details JL22461-02 96 Tests
Bovine Cross Linked C-telopeptide Of Type I Collagen (CTX-I) ELISA Kit
Sign In for Pricing
View Details 
MBS010325-01 48 Well
Horse Angiotensin 2 Receptor 1 Antibody ELISA Kit
Sign In for Pricing
View Details MBS010325-02 96 Well
Horse Angiotensin 2 Receptor 1 Antibody ELISA Kit
Sign In for Pricing
View Details MBS010325-03 5x 96 Well
Horse Angiotensin 2 Receptor 1 Antibody ELISA Kit
Sign In for Pricing
View Details