Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFN beta protein

This Human IFN beta protein spans the amino acid sequence from region 22-187aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast interferon

UniProt

P01574

Expression Region

22-187aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Striatin-4 (STRN4) ELISA Kit
AE15741HU-01 48 Tests

Human Striatin-4 (STRN4) ELISA Kit

Sign In for Pricing
View Details
Human Striatin-4 (STRN4) ELISA Kit
AE15741HU-02 96 Tests

Human Striatin-4 (STRN4) ELISA Kit

Sign In for Pricing
View Details
MRPS12 antibody
70R-2407 50 ug

MRPS12 antibody

Sign In for Pricing
View Details
Recombinant Human YV008 Protein
E30P11838 20 µg

Recombinant Human YV008 Protein

Sign In for Pricing
View Details
Apixaban
S1593-1g 1 g

Apixaban

Sign In for Pricing
View Details
Aox3l1 sgRNA CRISPR Lentivector set (Rat)
K6089801 3x 1.0 µg

Aox3l1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details