Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDNF protein

This Human GDNF protein spans the amino acid sequence from region 78-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Astrocyte-derived trophic factor , ATF

UniProt

P39905

Expression Region

78-211aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNL1 Antibody, HRP conjugated
A23507-50UG 50 µg

GNL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mouse Monoclonal beta Tubulin Antibody (BT7R) [mFluor Violet 610 SE]
NBP2-37830MFV610 0.1 mL

Mouse Monoclonal beta Tubulin Antibody (BT7R) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
CUL5 sgRNA CRISPR Lentivector (Human) (Target 2)
K0532703 1.0 µg DNA

CUL5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b Cell division protein SepF (sepF)
MBS1121791-01 0.02 mg (E-Coli)

Recombinant Listeria welshimeri serovar 6b Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b Cell division protein SepF (sepF)
MBS1121791-02 0.1 mg (E-Coli)

Recombinant Listeria welshimeri serovar 6b Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b Cell division protein SepF (sepF)
MBS1121791-03 0.02 mg (Yeast)

Recombinant Listeria welshimeri serovar 6b Cell division protein SepF (sepF)

Sign In for Pricing
View Details