Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDNF protein

This Human GDNF protein spans the amino acid sequence from region 78-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Astrocyte-derived trophic factor , ATF

UniProt

P39905

Expression Region

78-211aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse deubiquitinating enzyme (DUB) ELISA Kit
201-02-0953 96 Tests

Mouse deubiquitinating enzyme (DUB) ELISA Kit

Sign In for Pricing
View Details
CSC1 Antibody
orb786409 2 mg

CSC1 Antibody

Sign In for Pricing
View Details
3-Amino-1- (2,4-dichlorophenyl) piperidin-2-one
TDC65629-01 50 mg

3-Amino-1- (2,4-dichlorophenyl) piperidin-2-one

Sign In for Pricing
View Details
3-Amino-1- (2,4-dichlorophenyl) piperidin-2-one
TDC65629-02 0.5 g

3-Amino-1- (2,4-dichlorophenyl) piperidin-2-one

Sign In for Pricing
View Details
Mouse Monoclonal COX-2 Antibody (rCOX2/6996) [Alexa Fluor 532]
NBP3-21138AF532 0.1 mL

Mouse Monoclonal COX-2 Antibody (rCOX2/6996) [Alexa Fluor 532]

Sign In for Pricing
View Details
P-Nitrophenyl 2-O- (β-L-Fucopyranosyl) -β-D-galactopyranoside
sc-222118 1 mg

P-Nitrophenyl 2-O- (β-L-Fucopyranosyl) -β-D-galactopyranoside

Sign In for Pricing
View Details