Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL5 protein

This Human CXCL5 protein spans the amino acid sequence from region 37-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ENA-78 (1-78) Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5

UniProt

P42830

Expression Region

37-110aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C5orf45 shRNA Plasmid
abx959564-01 150 µg

Human C5orf45 shRNA Plasmid

Sign In for Pricing
View Details
Human C5orf45 shRNA Plasmid
abx959564-02 300 µg

Human C5orf45 shRNA Plasmid

Sign In for Pricing
View Details
(-) -Menthol
C10368-100mg 100 mg

(-) -Menthol

Sign In for Pricing
View Details
Plant Growth Chamber
LX203PGC 1 Unit

Plant Growth Chamber

Sign In for Pricing
View Details
XFD350 Anti-human CD15 Antibody *HI98*
10150140-AAT 100 Tests

XFD350 Anti-human CD15 Antibody *HI98*

Sign In for Pricing
View Details
LIM Domain Kinase 1, NT (LIMK1, LIMK-1, LIMK) (APC) discontinued
L2198-25N-APC 200 µL

LIM Domain Kinase 1, NT (LIMK1, LIMK-1, LIMK) (APC) discontinued

Sign In for Pricing
View Details