Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL5 protein

This Human CXCL5 protein spans the amino acid sequence from region 37-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ENA-78 (1-78) Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5

UniProt

P42830

Expression Region

37-110aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FEM 1B Rabbit Polyclonal Antibody (BF488)
orb2394780 100 µL

FEM 1B Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Sciellin (SCEL) (MaxLight 650)
MBS6224507-01 0.1 mL

Sciellin (SCEL) (MaxLight 650)

Sign In for Pricing
View Details
Sciellin (SCEL) (MaxLight 650)
MBS6224507-02 5x 0.1 mL

Sciellin (SCEL) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Rat Mannose-binding protein C (Mbl2)
MBS9020108-01 0.02 mg (E-Coli)

Recombinant Rat Mannose-binding protein C (Mbl2)

Sign In for Pricing
View Details
Recombinant Rat Mannose-binding protein C (Mbl2)
MBS9020108-02 0.1 mg (E-Coli)

Recombinant Rat Mannose-binding protein C (Mbl2)

Sign In for Pricing
View Details
Recombinant Rat Mannose-binding protein C (Mbl2)
MBS9020108-03 1 mg (E-Coli)

Recombinant Rat Mannose-binding protein C (Mbl2)

Sign In for Pricing
View Details