Human CXCL5 protein
This Human CXCL5 protein spans the amino acid sequence from region 37-110aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ENA-78 (1-78) Epithelial-derived neutrophil-activating protein 78Neutrophil-activating peptide ENA-78Small-inducible cytokine B5
UniProt
P42830
Expression Region
37-110aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15111930 1 Vial
Lentiviral human C11orf80 shRNA (UAS) - Lentiviral human C11orf80 shRNA (UAS) (100)
Sign In for Pricing
View Details 
GTR15218706 1 Vial
Lentiviral mouse Kng1 shRNA (UAS) - Lentiviral mouse Kng1 shRNA (UAS) (100)
Sign In for Pricing
View Details MBS6295930-01 0.2 mL
EPDR1, ID (EPDR1, MERP1, UCC1, Mammalian ependymin-related protein 1, Upregulated in colorectal cancer gene 1 protein) (AP)
Sign In for Pricing
View Details MBS6295930-02 5x 0.2 mL
EPDR1, ID (EPDR1, MERP1, UCC1, Mammalian ependymin-related protein 1, Upregulated in colorectal cancer gene 1 protein) (AP)
Sign In for Pricing
View Details 