Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL13 protein

This Human CXCL13 protein spans the amino acid sequence from region 23-95aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AngieB cell-attracting chemokine 1 , BCA-1B lymphocyte chemoattractantCXC chemokine BLCSmall-inducible cytokine B13

UniProt

O43927

Expression Region

23-95aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc148 (NM_001107732) Rat Untagged Clone
RN205424 10 µg

Ccdc148 (NM_001107732) Rat Untagged Clone

Sign In for Pricing
View Details
LEPREL2 Protein Vector (Rat) (pPB-N-His)
PV277367 500 ng

LEPREL2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
C-myc (Myc, myc-1, Cellular myelocytomatosis oncogene, Myc2, Niard, Nird, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog) (MaxLight 750) discontinued
C0030-03K-ML750 100 µL

C-myc (Myc, myc-1, Cellular myelocytomatosis oncogene, Myc2, Niard, Nird, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog) (MaxLight 750) discontinued

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2128155-01 0.1 mL

APC Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2128155-02 0.2 mL

APC Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2128155-03 0.5 mL

APC Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details