Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CNTF protein

This Human CNTF protein spans the amino acid sequence from region 4-196aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ciliary neurotrophic factor, CNTF, CNTF_HUMAN, HCNTF

UniProt

P26441

Expression Region

4-196aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SOX2 Antibody
SOX2-0100 500 μL

Anti-SOX2 Antibody

Sign In for Pricing
View Details
CB086 Antibody (C-term) Blocking peptide
MBS9217873-01 0.5 mg

CB086 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
CB086 Antibody (C-term) Blocking peptide
MBS9217873-02 5x 0.5 mg

CB086 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
FAM200A Polyclonal Antibody
E-AB-17941-01 20 µL

FAM200A Polyclonal Antibody

Sign In for Pricing
View Details
FAM200A Polyclonal Antibody
E-AB-17941-02 60 µL

FAM200A Polyclonal Antibody

Sign In for Pricing
View Details
FAM200A Polyclonal Antibody
E-AB-17941-03 120 µL

FAM200A Polyclonal Antibody

Sign In for Pricing
View Details