Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL24 protein

This Human CCL24 protein spans the amino acid sequence from region 27-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CK-beta-6Eosinophil chemotactic protein 2Eotaxin-2Myeloid progenitor inhibitory factor 2 , MPIF-2Small-inducible cytokine A24

UniProt

O00175

Expression Region

27-119aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2BNB (BORCS8) Human shRNA Plasmid Kit (Locus ID 729991)
TR321421 1 Kit

MEF2BNB (BORCS8) Human shRNA Plasmid Kit (Locus ID 729991)

Sign In for Pricing
View Details
Rabbit Anti-Human SERPINE1 pAb
PA8380-01 50 μL

Rabbit Anti-Human SERPINE1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SERPINE1 pAb
PA8380-02 100 μL

Rabbit Anti-Human SERPINE1 pAb

Sign In for Pricing
View Details
Anti-CD31 Antibody-PE labled
MBS8224846-01 50 Assays

Anti-CD31 Antibody-PE labled

Sign In for Pricing
View Details
Anti-CD31 Antibody-PE labled
MBS8224846-02 100 Assays

Anti-CD31 Antibody-PE labled

Sign In for Pricing
View Details
Anti-CD31 Antibody-PE labled
MBS8224846-03 5x 100 Assays

Anti-CD31 Antibody-PE labled

Sign In for Pricing
View Details