Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL24 protein

This Human CCL24 protein spans the amino acid sequence from region 27-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CK-beta-6Eosinophil chemotactic protein 2Eotaxin-2Myeloid progenitor inhibitory factor 2 , MPIF-2Small-inducible cytokine A24

UniProt

O00175

Expression Region

27-119aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP28, Human (sf9, His)
HY-P701447-01 10 µg

USP28, Human (sf9, His)

Sign In for Pricing
View Details
USP28, Human (sf9, His)
HY-P701447-02 50 µg

USP28, Human (sf9, His)

Sign In for Pricing
View Details
Goose Bcl2/AdenoVirus E1B 19kDa Interacting Protein 3 ELISA Kit
MBS072380 Inquire

Goose Bcl2/AdenoVirus E1B 19kDa Interacting Protein 3 ELISA Kit

Sign In for Pricing
View Details
Olr673 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
34588066 1.0 µg DNA

Olr673 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
C5orf42 ORF Vector (Human) (pORF)
ORF016675 1.0 µg DNA

C5orf42 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MAPK8IP1 Antibody / JIP1
F55015-0.4ML 0.4 mL

MAPK8IP1 Antibody / JIP1

Sign In for Pricing
View Details