Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Caspase 1 protein

This Human Caspase 1 protein spans the amino acid sequence from region 120-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-1 beta convertase , IL-1BCInterleukin-1 beta-converting enzyme , ICE , IL-1 beta-converting enzymep45

UniProt

P29466

Expression Region

120-269aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase-related Protein 1, TRP1, TRP-1, TRP, TYRP, TYRRP, 5,6-dihydroxyindole-2-carboxylic Acid Oxidase, DHICA Oxidase, Catalase B, CATB, CAS2, Glycoprotein 75, GP75, Melanoma Antigen gp75) (Biotin)
MBS6397778-01 0.1 mL

TYRP1 (Tyrosinase-related Protein 1, TRP1, TRP-1, TRP, TYRP, TYRRP, 5,6-dihydroxyindole-2-carboxylic Acid Oxidase, DHICA Oxidase, Catalase B, CATB, CAS2, Glycoprotein 75, GP75, Melanoma Antigen gp75) (Biotin)

Sign In for Pricing
View Details
TYRP1 (Tyrosinase-related Protein 1, TRP1, TRP-1, TRP, TYRP, TYRRP, 5,6-dihydroxyindole-2-carboxylic Acid Oxidase, DHICA Oxidase, Catalase B, CATB, CAS2, Glycoprotein 75, GP75, Melanoma Antigen gp75) (Biotin)
MBS6397778-02 5x 0.1 mL

TYRP1 (Tyrosinase-related Protein 1, TRP1, TRP-1, TRP, TYRP, TYRRP, 5,6-dihydroxyindole-2-carboxylic Acid Oxidase, DHICA Oxidase, Catalase B, CATB, CAS2, Glycoprotein 75, GP75, Melanoma Antigen gp75) (Biotin)

Sign In for Pricing
View Details
Fmoc-Arg-OH
4003163.0025 25 g

Fmoc-Arg-OH

Sign In for Pricing
View Details
Compound T130232
orb3172137-01 1 mg

Compound T130232

Sign In for Pricing
View Details
Compound T130232
orb3172137-02 2 mg

Compound T130232

Sign In for Pricing
View Details
Compound T130232
orb3172137-03 3 mg

Compound T130232

Sign In for Pricing
View Details