Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Caspase 1 protein

This Human Caspase 1 protein spans the amino acid sequence from region 120-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-1 beta convertase , IL-1BCInterleukin-1 beta-converting enzyme , ICE , IL-1 beta-converting enzymep45

UniProt

P29466

Expression Region

120-269aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znf291 3'UTR GFP Stable Cell Line
TU273898 1.0 mL

Znf291 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Ptprn Pre-designed siRNA Set A
SI211378A 1 Each

Rat Ptprn Pre-designed siRNA Set A

Sign In for Pricing
View Details
Fatty Acid Binding Protein, Heart (Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid Binding Protein 3, FABP3, FABP11, Mammary-derived Growth Inhibitor, MDGI, Muscle Fatty Acid Binding Protein, M-FABP, O-FABP) (APC) discontinued
F0019-76L5-APC 100 µL

Fatty Acid Binding Protein, Heart (Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid Binding Protein 3, FABP3, FABP11, Mammary-derived Growth Inhibitor, MDGI, Muscle Fatty Acid Binding Protein, M-FABP, O-FABP) (APC) discontinued

Sign In for Pricing
View Details
ROBO4 Rabbit Polyclonal Antibody
orb1743912 100 µg

ROBO4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human RPS4Y2 sgRNA gene knockout kit - Lentiviral human RPS4Y2 sgRNA gene knockout kit (plasmid)
GTR15385061 1 Vial

Lentiviral human RPS4Y2 sgRNA gene knockout kit - Lentiviral human RPS4Y2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
At1g13780 Antibody
orb788666 2 mg

At1g13780 Antibody

Sign In for Pricing
View Details