Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP7 protein

This Human BMP7 protein spans the amino acid sequence from region 293-431aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Osteogenic protein 1 , OP-1INN, Eptotermin alfa

UniProt

P18075

Expression Region

293-431aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chikungunya E2
MBS146710-01 0.1 mg

Recombinant Chikungunya E2

Sign In for Pricing
View Details
Recombinant Chikungunya E2
MBS146710-02 0.5 mg

Recombinant Chikungunya E2

Sign In for Pricing
View Details
Recombinant Chikungunya E2
MBS146710-03 1 mg

Recombinant Chikungunya E2

Sign In for Pricing
View Details
Recombinant Chikungunya E2
MBS146710-04 5x 1 mg

Recombinant Chikungunya E2

Sign In for Pricing
View Details
IFT88 Recombinant Antibody, PE-Cy5 Conjugated
bsm-62706R-PE-Cy5 100 µL

IFT88 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
[KO Validated] DBI Rabbit pAb
MBS9144416-01 0.02 mL

[KO Validated] DBI Rabbit pAb

Sign In for Pricing
View Details