Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HNRNPH1 protein

This Human HNRNPH1 protein spans the amino acid sequence from region 2-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DKFZp686A15170, Heterogeneous nuclear ribonucleoprotein H, Heterogeneous nuclear ribonucleoprotein H1 (H), Heterogeneous nuclear ribonucleoprotein H1, HNRH1_HUMAN, hnRNP H, hnRNPH, Hnrnph1, HNRPH 1, HNRPH, HNRPH1 protein, N-terminally processed

UniProt

P31943

Expression Region

2-216aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTH1P18 ORF Vector (Human) (pORF)
21009011 1.0 µg DNA

FTH1P18 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
A4GALT Polyclonal Antibody, PE-Cy5 Conjugated
bs-25228R-PE-Cy5 100 µL

A4GALT Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
CEPT1 Lentiviral Activation Particles (m)
sc-430281-LAC 200 µL

CEPT1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
OR1J2 (NM_054107) Human Over-expression Lysate
LH13370V 100 µg

OR1J2 (NM_054107) Human Over-expression Lysate

Sign In for Pricing
View Details
[Ser8]-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)
5-00305 4x 1 mg

[Ser8]-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)

Sign In for Pricing
View Details
USP4 (NM_003363) Human Recombinant Protein
TP324586L 1 mg

USP4 (NM_003363) Human Recombinant Protein

Sign In for Pricing
View Details