Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HNRNPH1 protein

This Human HNRNPH1 protein spans the amino acid sequence from region 2-216aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DKFZp686A15170, Heterogeneous nuclear ribonucleoprotein H, Heterogeneous nuclear ribonucleoprotein H1 (H), Heterogeneous nuclear ribonucleoprotein H1, HNRH1_HUMAN, hnRNP H, hnRNPH, Hnrnph1, HNRPH 1, HNRPH, HNRPH1 protein, N-terminally processed

UniProt

P31943

Expression Region

2-216aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

α8 Tubulin HDR Plasmid (m)
sc-424747-HDR 20 µg

α8 Tubulin HDR Plasmid (m)

Sign In for Pricing
View Details
Sult2a6-set siRNA/shRNA/RNAi Lentivector (Mouse)
45857094 4x 500 ng

Sult2a6-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Mouse Bridging Integrator 3 (BIN3) ELISA Kit
abx503791 96 Tests

Mouse Bridging Integrator 3 (BIN3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal RNF141 Antibody
NBP3-10331-100ul 100 µL

Rabbit Polyclonal RNF141 Antibody

Sign In for Pricing
View Details
Pinoresinol (Standard)
HY-N6253R 1 Each

Pinoresinol (Standard)

Sign In for Pricing
View Details
CD45 (B-8) Alexa Fluor® 647
sc-28369 AF647 200 µg/mL

CD45 (B-8) Alexa Fluor® 647

Sign In for Pricing
View Details