Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARL2BP protein

This Human ARL2BP protein spans the amino acid sequence from region 1-163aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Binder of ARF2 protein 1

UniProt

Q9Y2Y0

Expression Region

1-163aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphorylase Kinase Catalytic Subunit Gamma 2 (PHKG2) Antibody
abx002948-01 100 µL

Phosphorylase Kinase Catalytic Subunit Gamma 2 (PHKG2) Antibody

Sign In for Pricing
View Details
Phosphorylase Kinase Catalytic Subunit Gamma 2 (PHKG2) Antibody
abx002948-02 200 µL

Phosphorylase Kinase Catalytic Subunit Gamma 2 (PHKG2) Antibody

Sign In for Pricing
View Details
Myoz1 (NM_021508) Mouse Recombinant Protein
PM47522M5 20 µg

Myoz1 (NM_021508) Mouse Recombinant Protein

Sign In for Pricing
View Details
Faah Rat Pre-designed siRNA Set A
HY-RS04652 1 Set

Faah Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mitofusin 1 Recombinant Antibody, Cy7 Conjugated
bsm-61383R-Cy7-TR 20 µL

Mitofusin 1 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
LIPA1 Polyclonal Antibody
BT-AP10919-01 20 µL

LIPA1 Polyclonal Antibody

Sign In for Pricing
View Details