Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARL2BP protein

This Human ARL2BP protein spans the amino acid sequence from region 1-163aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Binder of ARF2 protein 1

UniProt

Q9Y2Y0

Expression Region

1-163aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FMO3 Antibody Picoband® (FITC Conjugate)
PB9590-FITC 100 µg/Vial

Anti-FMO3 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
PRR23A Protein Lysate (Mouse) with C-HA Tag
37799034 100 µg

PRR23A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
SH3KBP1 (NM_001184960) Human Tagged ORF Clone
RC230063 10 µg

SH3KBP1 (NM_001184960) Human Tagged ORF Clone

Sign In for Pricing
View Details
SLC18A2 Antibody
OAAJ07561-100UL 100 µL

SLC18A2 Antibody

Sign In for Pricing
View Details
MYH14 Protein Lysate (Human) with C-Ha Tag
31231031 100 µg

MYH14 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
CDKN3 (39) : m-IgGκ BP-HRP Bundle
sc-521309 1 Kit

CDKN3 (39) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details