Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STARD7 protein

This Human STARD7 protein spans the amino acid sequence from region 61-307aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gestational trophoblastic tumor protein 1START domain-containing protein 7 , StARD7

UniProt

Q9NQZ5

Expression Region

61-307aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR40B shRNA Plasmid (h)
sc-90968-SH 20 µg

WDR40B shRNA Plasmid (h)

Sign In for Pricing
View Details
RNU6-53 Adenovirus (Human)
40477051 1.0 mL

RNU6-53 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Molybdenum cofactor biosynthesis protein A (moaA)
MBS1284844-01 0.02 mg (E-Coli)

Recombinant Shewanella denitrificans Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Molybdenum cofactor biosynthesis protein A (moaA)
MBS1284844-02 0.02 mg (Yeast)

Recombinant Shewanella denitrificans Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Molybdenum cofactor biosynthesis protein A (moaA)
MBS1284844-03 0.1 mg (E-Coli)

Recombinant Shewanella denitrificans Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans Molybdenum cofactor biosynthesis protein A (moaA)
MBS1284844-04 0.1 mg (Yeast)

Recombinant Shewanella denitrificans Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details