Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STARD7 protein

This Human STARD7 protein spans the amino acid sequence from region 61-307aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gestational trophoblastic tumor protein 1START domain-containing protein 7 , StARD7

UniProt

Q9NQZ5

Expression Region

61-307aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Endothelin 3 (EDN3) ELISA kit
GTR10453711 96 Well

Mouse Endothelin 3 (EDN3) ELISA kit

Sign In for Pricing
View Details
Progesterone Standard, 40UL
C252-40UL 40UL

Progesterone Standard, 40UL

Sign In for Pricing
View Details
IFluor® 488 Anti-human CD4 Antibody *RPA-T4*
10041050-AAT 100 Tests

IFluor® 488 Anti-human CD4 Antibody *RPA-T4*

Sign In for Pricing
View Details
WWOX Antibody Blocking peptide
orb1455629 500 µg

WWOX Antibody Blocking peptide

Sign In for Pricing
View Details
Rat Growth Differentiation Factor 3 (GDF3) ELISA Kit
EKU04596 96 Tests

Rat Growth Differentiation Factor 3 (GDF3) ELISA Kit

Sign In for Pricing
View Details
NEK3 AAV Vector (Mouse) (CMV)
31707104 1 µg

NEK3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details