Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HADHB protein

This Human HADHB protein spans the amino acid sequence from region 35-283aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TP-beta 1 domains, 3-ketoacyl-CoA thiolase (EC, 2.3.1.16), Acetyl-CoA acyltrans feraseBeta-ketothiolase

UniProt

P55084

Expression Region

35-283aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT23 siRNA Oligos set (Human)
26010171 3x 5 nmol

KRT23 siRNA Oligos set (Human)

Sign In for Pricing
View Details
MIRacle™ hsa-miR-297 miRNA Agomir/Antagomir
AM0879 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-297 miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Mouse Nceh1/Neutral cholesterol ester hydrolase 1 ELISA Kit
MBS2907426-01 48 Well

Mouse Nceh1/Neutral cholesterol ester hydrolase 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Nceh1/Neutral cholesterol ester hydrolase 1 ELISA Kit
MBS2907426-02 96 Well

Mouse Nceh1/Neutral cholesterol ester hydrolase 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Nceh1/Neutral cholesterol ester hydrolase 1 ELISA Kit
MBS2907426-03 5x 96 Well

Mouse Nceh1/Neutral cholesterol ester hydrolase 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Nceh1/Neutral cholesterol ester hydrolase 1 ELISA Kit
MBS2907426-04 10x 96 Well

Mouse Nceh1/Neutral cholesterol ester hydrolase 1 ELISA Kit

Sign In for Pricing
View Details